Cell Culture Media, Supplements, and Reagents
Medchemexpress LLC HY-112620 10mg Medchemexpress, MS21570 CAS:65373-29-7 Purity:>98%
Medchemexpress, HY-112620 10mg MS21570 CAS:65373-29-7 MS21570 is a selective GPR171 antagonist, with an IC50 of 220 nM. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Dalcetrapib | 211513-37-0 | MFCD06407886 | 99.2% | 389.59 | 50 MG
Dalcetrapib is an orally active cholesteryl ester transfer protein (CETP) inhibitor. It has shown activity against recombinant human CETP and human plasma CETP, playing a role in cholesterol metabolism research.
- Inhibits cholesteryl ester transfer protein activity
- Increases pre-β-HDL formation
- Increases plasma HDL cholesterol
- Promotes fecal elimination of neutral sterols and bile acids
Medchemexpress LLC MRTX-EX185 (formic) | 2988148-70-3 | 97.2% | C34H35FN6O4 | 10MG
MRTX-EX185 (formic) is a small-molecule inhibitor of KRAS with potent activity against the oncogenic G12D mutant (IC50 = 90 nM). It binds both GDP-loaded and GNP (GTP-mimetic) states of KRAS and is intended for biochemical, cellular, and tumor-model research. The compound is supplied as a purified solid (yellow to brown), with reported purity around 97.2%, molecular formula C34H35FN6O4, and molecular weight 610.68 g·mol⁻¹.
- Potent KRAS G12D inhibition (IC50 = 90 nM).
- Binds both GDP-loaded and GTP-mimetic states of KRAS.
- Applicable to in vitro and in vivo research studies.
- High reported purity, suitable for research use.
- Readily soluble in DMSO (125 mg/mL) for assay preparation.
- Stable as powder when stored at -20°C for long-term storage.
Medchemexpress LLC HY-15648A 10mg Medchemexpress, GSK-J2 CAS:1394854-52-4 Purity:>98%
Medchemexpress, HY-15648A 10mg GSK-J2 CAS:1394854-52-4 GSK-J2 is an isomer of GSK-J1 that does not have any specific activity. GSK-J1 is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
TARGETMOL CHEMICALS INC AZITHROMYCIN 500MG
Also available in 50 mg 100 mg 1 mL 10 mM (in DMSO) and bulk. Please contact Fisher for quotes. Azithromycin (CP 62993) is an antibiotic by inhibiting protein synthesis used for the treatment of bacterial infections. purity: 99%
Medchemexpress LLC Azithromycin-13C,d3 | 2750534-82-6 | 99.9% | 753.00 | 500 UG
Azithromycin-13C,d3 is the deuterium and 13C labeled Azithromycin. Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs.
- This compound can be used as a tracer.
- This compound can be used as an internal standard for quantitative analysis by NMR, GC-MS, or LC-MS.
Medchemexpress LLC AZD 6482 (KIN-193) | 1173900-33-8 | MFCD16659062 | 99.9% | 408.45 g/mol | C22H24N4O4 | 100 MG
AZD 6482 is a potent, selective inhibitor of the p110β (PI3Kβ) isoform of phosphoinositide 3-kinase, used as a research tool to probe PI3Kβ-dependent signaling in biochemical and cellular assays. It offers subnanomolar potency against PI3Kβ with a characterized selectivity profile across related PI3K isoforms.
- Potent PI3Kβ inhibitor with IC50 = 0.69 nM.
- Selectivity profile includes higher IC50 values for PI3Kδ, PI3Kγ, and PI3Kα.
- High chemical purity (99.93%).
- Molecular formula C22H24N4O4; molecular weight 408.45 g/mol.
- Available as solid and as 10 mM solution in DMSO for assay use.
- For laboratory research use only; not for human or clinical applications.
eMolecules 1305115-80-3 | Medchem Express | PF-04957325 | 1mg | 446265619 | HY-15426 | MFCD22665721 | 400.38 | C14H15F3N8OS
Pharmablock | 1-(6-chloro-2-pyridyl)ethanone | 25mg | 769195911 | PBU8474 | 152356-57-5 | MFCD07375070 | 155.580 | C7H6ClNO
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Medchemexpress LLC HY-14286 500mg , Levosimendan OR1259 CAS:141505-33-1 Purity:98%
Medchemexpress, HY-14286 500mg Levosimendan OR1259 CAS:141505-33-1 Formula:C14H12N6O Purity:98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC HY-13782A 10mg Medchemexpress, Tenofovir (Disoproxil) CAS:201341-05-1 Purity:>98%
Medchemexpress, HY-13782A 10mg Tenofovir (Disoproxil) CAS:201341-05-1 Tenofovir Disoproxil (Bis(POC)-PMPA) is a nucleotide reverse transcriptase inhibitor to treat HIV and chronic Hepatitis B. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 1MG
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Medchemexpress LLC HY-17420 500mg , Cyclophosphamide CAS:50-18-0 Purity:98%
Medchemexpress, HY-17420 500mg Cyclophosphamide CAS:50-18-0 Formula:C7H15Cl2N2O2P Purity:98% Cyclophosphamide is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic and immunosuppressive activities. Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Recilisib | 334969-03-8 | MFCD07366276 | 99.9% | 336.79 g/mol | C16H13ClO4S | 50 MG
Recilisib (ON 01210) is a small-molecule radioprotectant reported to activate AKT and PI3K signaling in cells. It is supplied as a high-purity research reagent with recommended solvent guidance and multiple packaging formats for in vitro and in vivo studies.
- High purity suitable for research use.
- Activates AKT and PI3K signaling in cellular assays.
- Soluble in DMSO; protocols available for in vitro and in vivo dosing.
- Offered as solids, solutions, and sample formats.
- Multiple package sizes to support screening and scale-up.
Medchemexpress LLC TTA-A2 | 953778-63-7 | MFCD16628062 | 99.3% | 378.39 g/mol | C20H21F3N2O2 | 5 MG
TTA-A2 is a potent, selective, orally active T-type voltage-gated calcium channel antagonist used in preclinical neuroscience research. It shows low-nanomolar potency against Cav3.1 and Cav3.2 channels and is supplied as a high-purity solid for laboratory use.
- Potent T-type calcium channel antagonist (IC50 ≈ 89-92 nM).
- Low-nanomolar potency against Cav3.1 and Cav3.2.
- High purity (~99.3%).
- Molecular weight 378.39 g/mol; formula C20H21F3N2O2.
- Solid form; powder stable at -20°C for up to 3 years.
- In solvent: stable at -80°C for 6 months or -20°C for 1 month.
- Intended for research use in studies of sleep disorders, epilepsy, and related neurological models.
- Available in small-mass quantities for in vitro and in vivo experiments.
Medchemexpress LLC Sirtuin modulator 2 | 667910-69-2 | 99.2% | 349.41 | 5 MG
Sirtuin modulator 2 (Compound 132) is a sirtuin modulator that exhibits an ED50 equal to or less than 50 μM. This product is intended for research use only.
- Sirtuin modulator with an ED50 ≤ 50 μM
- Available in various quantities (5 mg, 10 mg, 25 mg, 50 mg)
- High purity of 99.22%
- Chemical structure provided
- Solubility information available for *in vitro* and *in vivo* applications